Structure of PDB 8r55 Chain M

Receptor sequence

>8r55M (length=108) Species: 1423 (Bacillus subtilis) [Search protein sequence]

RIAGVDIPRDKRVVISLTYIFGIGRTTAQQVLKEAGVSEDTRVRDLTEEE
LGKIRDIIDKLKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQNS
KNNARTRK

3D structure

PDB

8r55 B. subtilis MutS2 splits stalled ribosomes into subunits without mRNA cleavage.

Chain

Resolution

3.57 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	K13 R14 I17 Y21 F23 G24 I25 G26 R27 T28 T29 R44 V73 N76 R87 R90 H91 L95 V97 R98 Q100 N101 S102 K103 N104 N105 A106 R107 T108 R109 K110	K11 R12 I15 Y19 F21 G22 I23 G24 R25 T26 T27 R42 V71 N74 R85 R88 H89 L93 V95 R96 Q98 N99 S100 K101 N102 N103 A104 R105 T106 R107 K108
BS02	rna	M	R92 R93	R90 R91

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

External links