Structure of PDB 8r08 Chain M

Receptor sequence

>8r08M (length=123) Species: 9606 (Homo sapiens)

VNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIV
MAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVT
IKEGSQLKQQIQSIQQSIERLLV

3D structure

• PDB: 8r08 Structural insights into the cross-exon to cross-intron spliceosome switch
• Chain: M
• Resolution: 6.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	N31 G38 N40 E41 V95 S96 R97 P98 V99 I100 Q111	N26 G33 N35 E36 V90 S91 R92 P93 V94 I95 Q106
BS02	rna	M	Q111 L112	Q106 L107

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030515 snoRNA binding
• GO:0030621 U4 snRNA binding
• GO:0030622 U4atac snRNA binding
• GO:0034511 U3 snoRNA binding
• GO:0034512 box C/D sno(s)RNA binding
• GO:0051117 ATPase binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0000492 box C/D snoRNP assembly
• GO:0006397 mRNA processing
• GO:0007338 single fertilization
• GO:0008380 RNA splicing
• GO:0030490 maturation of SSU-rRNA
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0001651 dense fibrillar component
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005690 U4atac snRNP
• GO:0005730 nucleolus
• GO:0031428 box C/D methylation guide snoRNP complex
• GO:0032040 small-subunit processome
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071011 precatalytic spliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8r08, PDBe:8r08, PDBj:8r08
• PDBsum: 8r08
• PubMed: 38778104
• UniProt: P55769|NH2L1_HUMAN NHP2-like protein 1 (Gene Name=SNU13)