Structure of PDB 8q5i Chain M

Receptor sequence

>8q5iM (length=135) Species: 5476 (Candida albicans) [Search protein sequence]

LTVQSERAFQKQPHIFTNPKTKRWYKDVGLGFKTPKAAIEGSYIDKKCPF
AGTVSIRGKILTGTVVSTKMHRTIIIRRDYLHYVPKYNRYEKRHKNVAAH
VSPAFRVEEGDVVTVGQCRPISKTVRFNVLKVSAG

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	E10 P17 H18 F20 W34 K36 D37 V38 G39 L40 K56 K57 S65 I66 R67 K69 S77 K79 M80 H81 T83 I85 R87 R88 Y90 H92 K96 Y97 K102 R103 H104 K105 N106 Q127 R129 P130 I131 S132 K133 T134 R136 F137	E6 P13 H14 F16 W24 K26 D27 V28 G29 L30 K46 K47 S55 I56 R57 K59 S67 K69 M70 H71 T73 I75 R77 R78 Y80 H82 K86 Y87 K92 R93 H94 K95 N96 Q117 R119 P120 I121 S122 K123 T124 R126 F127
BS02	MG	M	E101 K102	E91 K92

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum	8q5i
PubMed
UniProt	A0A1D8PN83\|RS11A_CANAL Small ribosomal subunit protein uS17 (Gene Name=orf19.4149.1)