Structure of PDB 8pp7 Chain M

Receptor sequence
>8pp7M (length=100) Species: 9606 (Homo sapiens) [Search protein sequence]
RTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKY
CPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHP
3D structure
PDB8pp7 Structural basis of the histone ubiquitination read-write mechanism of RYBP-PRC1.
ChainM
Resolution2.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN M C18 C21 C39 C16 C19 C37
BS02 ZN M C34 H36 C53 C32 H34 C51
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:0071535 RING-like zinc finger domain binding
GO:0097027 ubiquitin-protein transferase activator activity
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001501 skeletal system development
GO:0001701 in utero embryonic development
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006346 DNA methylation-dependent heterochromatin formation
GO:0006959 humoral immune response
GO:0007379 segment specification
GO:0007420 brain development
GO:0010468 regulation of gene expression
GO:0021903 rostrocaudal neural tube patterning
GO:0030097 hemopoiesis
GO:0030890 positive regulation of B cell proliferation
GO:0033092 positive regulation of immature T cell proliferation in thymus
GO:0045814 negative regulation of gene expression, epigenetic
GO:0048103 somatic stem cell division
GO:0048146 positive regulation of fibroblast proliferation
GO:0048704 embryonic skeletal system morphogenesis
GO:0048706 embryonic skeletal system development
GO:0051443 positive regulation of ubiquitin-protein transferase activity
GO:0097190 apoptotic signaling pathway
GO:2000011 regulation of adaxial/abaxial pattern formation
GO:2001234 negative regulation of apoptotic signaling pathway
Cellular Component
GO:0000151 ubiquitin ligase complex
GO:0000792 heterochromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016604 nuclear body
GO:0031519 PcG protein complex
GO:0035102 PRC1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pp7, PDBe:8pp7, PDBj:8pp7
PDBsum8pp7
PubMed38528151
UniProtP35226|BMI1_HUMAN Polycomb complex protein BMI-1 (Gene Name=BMI1)

[Back to BioLiP]