Structure of PDB 8p2f Chain M

Receptor sequence

>8p2fM (length=144) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

MRQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVD
TGDYVIVINASKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPER
LIENSIKGMLPSTRLGEKQGKKLFVYGGAEHPHAAQQPENYELR

3D structure

• PDB: 8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
• Chain: M
• Resolution: 2.44 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	M1 R2 Q3 T4 M6 W16 T25 G27 R28 S31 S35 R38 K40 H48 Y54 T66 G67 K69 K73 Y75 Y76 R77 H78 S79 H81 P82 G83 I85 K86 R100 E103 S105 G108 M109 P111 T113 R114 L115 K121 P132 H133 A135 Q136 Q137 R144	M1 R2 Q3 T4 M6 W16 T25 G27 R28 S31 S35 R38 K40 H48 Y54 T66 G67 K69 K73 Y75 Y76 R77 H78 S79 H81 P82 G83 I85 K86 R100 E103 S105 G108 M109 P111 T113 R114 L115 K121 P132 H133 A135 Q136 Q137 R144

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
• PDBsum: 8p2f
• PubMed: 38902339
• UniProt: Q2FW38|RL13_STAA8 Large ribosomal subunit protein uL13 (Gene Name=rplM)