Structure of PDB 8ovd Chain M

Receptor sequence

>8ovdM (length=380) Species: 1772 (Mycolicibacterium smegmatis)

QPTDAELAEMSREELVKLGGKIDGVETIFKEPRWPVPGTKAEKRTERLVA
YWLMLGGLSGLALLLVFLFWPWEYQPFGSEGEFLYSLATPLYGLTFGLSI
LSIGIGAVLFQKKFIPEEISVQDRHDGRSPEVHRKTVAANLTDALEGSTL
KRRKVIGLSLGIGLGAFGAGTLVAFIGGLIKNPWKPVVPTAEGKKAVLWT
SGWTPRFKGETIYLARATGRPGESPFVKMRPEDIDAGGMETVFPWRESDG
DGTTVESEHKLTEIAMGVRNPVMLIRIKPADMHRVIKRKGQESFNFGELF
AYTKVCSHLGCPSSLYEQQTYRILCPCHQSQFDALEFAKPIFGPAARALA
QLPITIDEDGYLVANGDFVEPVGPAFWERK

3D structure

• PDB: 8ovd Long-range charge transfer mechanism of the III 2 IV 2 mycobacterial supercomplex.
• Chain: M
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	M	F247 G249 E250 T251 K327 R328 K329 E332 S333 N335 A388 T395 I396 D397 E398 V403	F207 G209 E210 T211 K287 R288 K289 E292 S293 N295 A348 T355 I356 D357 E358 V363
BS02	FES	M	C346 H348 L349 C351 C365 H368 S370	C306 H308 L309 C311 C325 H328 S330
BS03	IZL	M	W224 K235 W239 W417 E418 R419 K420	W184 K195 W199 W377 E378 R379 K380
BS04	9YF	M	G217 G218 I220 K221 N222	G177 G178 I180 K181 N182
BS05	MQ9	M	G201 L204 G205 G208 F215	G161 L164 G165 G168 F175
BS06	MQ9	M	F136 I140	F96 I100
BS07	9YF	M	L108 W112	L68 W72

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:8ovd, PDBe:8ovd, PDBj:8ovd
• PDBsum: 8ovd
• PubMed: 38902248
• UniProt: A0R051