Structure of PDB 8kab Chain M

Receptor sequence

>8kabM (length=145) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]

VIKLHDLKPAPGEKKAKTRVGRGEGSKGKTAGRGTKGTKARKNVPVMFEG
GQMPIHMRLPKLKGFKNRFRTEYQVVNVGDINKAFPQGGTVGVDELVAKG
LVRKNSLVKVLGDGKLTVKVDVTANKFSGSAREAITAAGGSATEL

3D structure

PDB

8kab Cryo-EM structures reveal the molecular mechanism of HflX-mediated erythromycin resistance in mycobacteria.

Chain

Resolution

3.3 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	H7 K10 E15 K16 K17 K19 T20 R21 V22 G23 R24 G25 G27 S28 G30 K31 A33 G34 R35 G36 T37 K38 T40 K41 R43 K44 F50 E51 G52 G53 Q54 M55 M59 R60 L61 P62 K63 K65 G66 F67 N69 R70 F71 R72 V77 N79 R105 K111 L113 G114 D115 S130 G131 S132	H5 K8 E13 K14 K15 K17 T18 R19 V20 G21 R22 G23 G25 S26 G28 K29 A31 G32 R33 G34 T35 K36 T38 K39 R41 K42 F48 E49 G50 G51 Q52 M53 M57 R58 L59 P60 K61 K63 G64 F65 N67 R68 F69 R70 V75 N77 R103 K109 L111 G112 D113 S128 G129 S130

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links