Structure of PDB 8k3o Chain M

Receptor sequence
>8k3oM (length=97) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVR
3D structure
PDB8k3o Cryo-EM structure of 30S ribosome with cleaved AP-mRNA bound complex I
ChainM
Resolution3.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M I16 G25 K26 T27 R28 Y85 R86 H90 P95 R97 I16 G25 K26 T27 R28 Y85 R86 H90 P95 R97
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k3o, PDBe:8k3o, PDBj:8k3o
PDBsum8k3o
PubMed
UniProtP0A7S9|RS13_ECOLI Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]