Structure of PDB 8jw0 Chain M

Receptor sequence

>8jw0M (length=168) Species: 2961 (Amphidinium carterae)

FAGGLTGSDYGGFGGKYEWDPVGFSTRWPEHLAWYREAELKHGRIAMLAF
AGLLAPDLFRLPWAEFQDSSLDFANAHDKFVAGFGPMWWGFIACGGIEYQ
RFRKLGLGMEGLTLENAGNLGWFDLPKNSEERLFYETAELKNGRLAMLAV
SGIFTAGIFWDQHHFPFI

3D structure

• PDB: 8jw0 Structures and organizations of PSI-AcpPCI supercomplexes from red tidal and coral symbiotic photosynthetic dinoflagellates.
• Chain: M
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DD6	M	R258 L259 L262 F273	R144 L145 L148 F159
BS02	DD6	M	W133 D134 P135 H156 A163 F187 M261 F268	W19 D20 P21 H42 A49 F73 M147 F154
BS03	DD6	M	M161 F164 F237 Y249 L259 A260 A263 I267	M47 F50 F123 Y135 L145 A146 A149 I153
BS04	DD6	M	W133 H191 L262 S265 F268	W19 H77 L148 S151 F154
BS05	KC1	M	G125 G126 F127 Y131 K255	G11 G12 F13 Y17 K141
BS06	CLA	M	Y124 F248 A252 K255 L259	Y10 F134 A138 K141 L145
BS07	CLA	M	G121 Y131 E132 W133 D134 F138 Y149 R150 E153 H156 R258 M261 L262	G7 Y17 E18 W19 D20 F24 Y35 R36 E39 H42 R144 M147 L148
BS08	CLA	M	W148 Y149 H156	W34 Y35 H42
BS09	CLA	M	L162 G166 P170 R174 L175 E179 S184 F194 M201	L48 G52 P56 R60 L61 E65 S70 F80 M87
BS10	CLA	M	W148 E151 A152 K155 H156 I159 F205 E212 F216	W34 E37 A38 K41 H42 I45 F91 E98 F102
BS11	CLA	M	R158 M161 L162 G232 N233 L234 G235 F237 D238 L239 P240 Y249 E250 E253 N256	R44 M47 L48 G118 N119 L120 G121 F123 D124 L125 P126 Y135 E136 E139 N142
BS12	KC1	M	F248 A252 N256	F134 A138 N142
BS13	CLA	M	G266 T269 W274 I282	G152 T155 W160 I168
BS14	CLA	M	H191 V195 M201 W202	H77 V81 M87 W88
BS15	KC1	M	G222 M223	G108 M109

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 19:31:37 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8jw0', asym_id = 'M', title = 'Structures and organizations of PSI-AcpPCI super...d coral symbiotic photosynthetic dinoflagellates.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8jw0', asym_id='M', title='Structures and organizations of PSI-AcpPCI super...d coral symbiotic photosynthetic dinoflagellates.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009765,0016020', uniprot = '', pdbid = '8jw0', asym_id = 'M'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009765,0016020', uniprot='', pdbid='8jw0', asym_id='M')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>