Structure of PDB 8j5o Chain M

Receptor sequence

>8j5oM (length=306) Species: 383372 (Roseiflexus castenholzii DSM 13941) [Search protein sequence]

PIDLHDEEYRDGLEGTIAKPPGHVGWMQRLLGEGQVGPIYVGLWGVISFI
TFFASAFIILVDYGRQVGWNPIIYLREFWNLAVYPPPTEYGLSWNVPWDK
GGAWLAATFFLHISVLTWWARLYTRAKATGVGTQLAWGFASALSLYFVIY
LFHPLALGNWSAAPGHGFRAILDWTNYVSIHWGNFYYNPFHMLSIFFLLG
STLLLAMHGATIVATSKWKSEMEFTEMMAEGPGTQRAQLFWRWVMGWNAN
SYNIHIWAWWFAAFTAITGAIGLFLSGTLVPDWYAWGETAKIVAPWPNPD
WAQYVF

3D structure

PDB

8j5o Carotenoid assembly regulates quinone diffusion and the Roseiflexus castenholzii reaction center-light harvesting complex architecture.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	M526 I529 F530 L533	M192 I195 F196 L199
BS02	BPH	M	T536 L537 M541	T202 L203 M207
BS03	FE	M	H542 E557 H589	H208 E223 H255
BS04	BPH	M	S448 W452 L469 F473	S114 W118 L135 F139
BS05	MQE	M	L538 H542 T545 W575 M579 N582 A583 I588 W591	L204 H208 T211 W241 M245 N248 A249 I254 W257
BS06	BCL	M	F386 L479 T509 S513 Y520 H525 S528 I529 L532 G603 L607	F52 L145 T175 S179 Y186 H191 S194 I195 L198 G269 L273
BS07	BPH	M	I505 L506 W508	I171 L172 W174
BS08	MQE	M	I393 H500 G501 I505	I59 H166 G167 I171

Gene Ontology

	Molecular Function
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0019684	photosynthesis, light reaction

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8j5o, PDBe:8j5o, PDBj:8j5o
PDBsum	8j5o
PubMed	37737710
UniProt	A7NQE8

[Back to BioLiP]