Structure of PDB 8iug Chain M

Receptor sequence

>8iugM (length=306) Species: 120962 (Roseiflexus castenholzii)

PIDLHDEEYRDGLEGTIAKPPGHVGWMQRLLGEGQVGPIYVGLWGVISFI
TFFASAFIILVDYGRQVGWNPIIYLREFWNLAVYPPPTEYGLSWNVPWDK
GGAWLAATFFLHISVLTWWARLYTRAKATGVGTQLAWGFASALSLYFVIY
LFHPLALGNWSAAPGHGFRAILDWTNYVSIHWGNFYYNPFHMLSIFFLLG
STLLLAMHGATIVATSKWKSEMEFTEMMAEGPGTQRAQLFWRWVMGWNAN
SYNIHIWAWWFAAFTAITGAIGLFLSGTLVPDWYAWGETAKIVAPWPNPD
WAQYVF

3D structure

• PDB: 8iug New insights on the photocomplex of Roseiflexus castenholzii revealed from comparisons of native and carotenoid-depleted complexes.
• Chain: M
• Resolution: 2.86 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	M	I529 F530 L533	I195 F196 L199
BS02	BPH	M	L537 M541	L203 M207
BS03	BPH	M	F383 L469 F473	F49 L135 F139
BS04	BCL	M	T509 V512 S513 F519 Y520 H525 S528 I529 G603	T175 V178 S179 F185 Y186 H191 S194 I195 G269
BS05	BPH	M	F502 I505 L506	F168 I171 L172
BS06	MN	M	H542 E557 H589	H208 E223 H255
BS07	MQE	M	H542 T545 Q572 W575 M579 W581 N582 A583 N584 I588 W591	H208 T211 Q238 W241 M245 W247 N248 A249 N250 I254 W257

Gene Ontology

Molecular Function

• GO:0016168 chlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex

External links

• PDB: RCSB:8iug, PDBe:8iug, PDBj:8iug
• PDBsum: 8iug
• PubMed: 37468106
• UniProt: Q83XD0