Structure of PDB 8ef6 Chain M

Receptor sequence

>8ef6M (length=287) Species: 9606 (Homo sapiens) [Search protein sequence]

SMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALA
DALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSV
DRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQG
SIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVR
MLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTF
QTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREF

3D structure

PDB

8ef6 Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	M	A170 P174 R181 M266 N276 R279 D342 E343 N344	A105 P109 R116 M201 N211 R214 D277 E278 N279
BS02	CLR	M	H173 K176	H108 K111
BS03	MOI	M	D149 Y150 M153 W320	D84 Y85 M88 W255
BS04	CLR	M	Y168 V252	Y103 V187
BS05	CLR	M	N111 Y151 W194	N46 Y86 W129
BS06	CLR	M	A199 W230 F241	A134 W165 F176
BS07	CLR	M	W228 Y229 N232	W163 Y164 N167

Gene Ontology

	Molecular Function
GO:0001965	G-protein alpha-subunit binding
GO:0004930	G protein-coupled receptor activity
GO:0004979	beta-endorphin receptor activity
GO:0004985	G protein-coupled opioid receptor activity
GO:0005245	voltage-gated calcium channel activity
GO:0005515	protein binding
GO:0031681	G-protein beta-subunit binding
GO:0038047	morphine receptor activity
GO:0042923	neuropeptide binding

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007197	adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007218	neuropeptide signaling pathway
GO:0007600	sensory perception
GO:0008285	negative regulation of cell population proliferation
GO:0019233	sensory perception of pain
GO:0038003	G protein-coupled opioid receptor signaling pathway
GO:0048149	behavioral response to ethanol
GO:0050769	positive regulation of neurogenesis
GO:0061358	negative regulation of Wnt protein secretion
GO:0070374	positive regulation of ERK1 and ERK2 cascade
GO:0070588	calcium ion transmembrane transport
GO:0071315	cellular response to morphine
GO:0080135	regulation of cellular response to stress
GO:2000310	regulation of NMDA receptor activity

	Cellular Component
GO:0005737	cytoplasm
GO:0005768	endosome
GO:0005783	endoplasmic reticulum
GO:0005794	Golgi apparatus
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0030424	axon
GO:0030425	dendrite
GO:0042995	cell projection
GO:0043005	neuron projection
GO:0043204	perikaryon
GO:0045202	synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ef6, PDBe:8ef6, PDBj:8ef6
PDBsum	8ef6
PubMed	36368306
UniProt	P35372\|OPRM_HUMAN Mu-type opioid receptor (Gene Name=OPRM1)

[Back to BioLiP]