Structure of PDB 8cgi Chain M

Receptor sequence

>8cgiM (length=115) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]

ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKPI

3D structure

PDB

8cgi Structural conservation of antibiotic interaction with ribosomes.

Chain

Resolution

1.89 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	K13 H14 I17 Y23 G24 V25 G26 T28 R29 S76 Y86 R87 R90 H91 P96 V97 R98 G99 Q100 R101 T102 K103 T104 N105 A106 R107 T108 R109 K110 R113 K114 I116	K12 H13 I16 Y22 G23 V24 G25 T27 R28 S75 Y85 R86 R89 H90 P95 V96 R97 G98 Q99 R100 T101 K102 T103 N104 A105 R106 T107 R108 K109 R112 K113 I115
BS02	MG	M	T20 I22 V25	T19 I21 V24

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8cgi, PDBe:8cgi, PDBj:8cgi
PDBsum	8cgi
PubMed	37550453
UniProt	P0A7S9\|RS13_ECOLI Small ribosomal subunit protein uS13 (Gene Name=rpsM)