Structure of PDB 8cee Chain M

Receptor sequence

>8ceeM (length=108) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

RIAGVDIPRDKRVVISLTYIFGIGRTTAQQVLKEAGVSEDTRVRDLTEEE
LGKIRDIIDKLKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQNS
KNNARTRK

3D structure

• PDB: 8cee Structural basis of ribosomal 30S subunit degradation by RNase R
• Chain: M
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	K13 R14 I17 F23 G24 I25 G26 R27 T28 T29 R44 N76 Y86 R87 R90 H91 L95 P96 V97 R98 Q100 N101 S102 K103 N104 N105 A106 R107 T108 R109 K110	K11 R12 I15 F21 G22 I23 G24 R25 T26 T27 R42 N74 Y84 R85 R88 H89 L93 P94 V95 R96 Q98 N99 S100 K101 N102 N103 A104 R105 T106 R107 K108

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8cee, PDBe:8cee, PDBj:8cee
• PDBsum: 8cee
• PubMed: 38326618
• UniProt: P20282|RS13_BACSU Small ribosomal subunit protein uS13 (Gene Name=rpsM)