Structure of PDB 8c88 Chain M

Receptor sequence

>8c88M (length=303) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]

AEYQNIFTQVQVRGPADLCMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HGM

3D structure

PDB

8c88 Stabilization of Cereibacter sphaeroides Photosynthetic Reaction Center by the Introduction of Disulfide Bonds.

Chain

Resolution

2.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	I206 A207 Y210	I206 A207 Y210
BS02	BPH	M	Y210 L214 W252	Y210 L214 W252
BS03	NKP	M	G143 K144 W148 W155 W271 L278	G143 K144 W148 W155 W271 L278
BS04	BCL	M	W66 F67 H182 L183	W66 F67 H182 L183
BS05	BCL	M	A153 L156 T186 N187 F189 L196 F197 H202 S205 I206 G280 I284	A153 L156 T186 N187 F189 L196 F197 H202 S205 I206 G280 I284
BS06	BPH	M	G63 W66 F67 W129 A149 F150 T277	G63 W66 F67 W129 A149 F150 T277
BS07	FE	M	H219 E234 H266	H219 E234 H266
BS08	U10	M	M218 H219 T222 A249 W252 M256 F258 N259 A260 I265 W268	M218 H219 T222 A249 W252 M256 F258 N259 A260 I265 W268
BS09	SPN	M	F67 F68 G71 W75 S119 F120 M122 W157 F162 W171 Y177 H182	F67 F68 G71 W75 S119 F120 M122 W157 F162 W171 Y177 H182

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8c88, PDBe:8c88, PDBj:8c88
PDBsum	8c88
PubMed	36837657
UniProt	Q3J1A6\|RCEM_CERS4 Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]