Structure of PDB 8buu Chain M

Receptor sequence

>8buuM (length=135) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEFGIQALEASWITNRQIEAA
RIAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPG
KVLFEISGVSEEVAREALRLASHKLPIKTKFVKRE

3D structure

PDB

8buu Genome-encoded ABCF factors implicated in intrinsic antibiotic resistance in Gram-positive bacteria: VmlR2, Ard1 and CplR.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	P4 K5 R6 K8 Y9 R11 E12 H13 R14 G15 K16 M17 R18 K22 H28 W41 R45 Q46 A49 R56 K63 W65 F69 K77 E80 V81 R82 M83 G84 S85 G86 K87 G88 K101 H123 K124 P126 K128	P4 K5 R6 K8 Y9 R11 E12 H13 R14 G15 K16 M17 R18 K22 H28 W41 R45 Q46 A49 R56 K63 W65 F69 K77 E80 V81 R82 M83 G84 S85 G86 K87 G88 K101 H123 K124 P126 K128
BS02	rna	M	K16 M17 R18 G19	K16 M17 R18 G19

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8buu, PDBe:8buu, PDBj:8buu
PDBsum	8buu
PubMed	36951104
UniProt	P14577\|RL16_BACSU Large ribosomal subunit protein uL16 (Gene Name=rplP)