Structure of PDB 8b64 Chain M

Receptor sequence

>8b64M (length=304) Species: 1061 (Rhodobacter capsulatus) [Search protein sequence]

AEYQNFFNQVQVAGAPEMGLKEDVDTFERTPAGMFNILGWMGNAQIGPIY
LGIAGTVSLAFGAAWFFTIGVWYWYQAGFDPFIFMRDLFFFSLEPPPAEY
GLAIAPLKQGGVWQIASLFMAISVIAWWVRVYTRADQLGMGKHMAWAFLS
AIWLWSVLGFWRPILMGSWSVAPPYGIFSHLDWTNQFSLDHGNLFYNPFH
GLSIAALYGSALLFAMHGATILAVTRFGGERELEQIVDRGTASERAALFW
RWTMGFNATMEGIHRWAIWMAVMVTLTGGIGILLSGTVVDNWYVWAQVHG
YAPV

3D structure

PDB

8b64 Cryo-EM structure of a monomeric RC-LH1-PufX supercomplex with high-carotenoid content from Rhodobacter capsulatus.

Chain

Resolution

2.589 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BPH	M	Y208 L212 M216 W250	Y208 L212 M216 W250
BS02	U10	M	R86 D87 L88 F89 F90 F178	R86 D87 L88 F89 F90 F178
BS03	BCL	M	G201 I204 A205 Y208 G209 L212	G201 I204 A205 Y208 G209 L212
BS04	FE	M	H217 E232 H264	H217 E232 H264
BS05	U10	M	M216 H217 T220 W250 M254 F256 N257 A258 T259 I263	M216 H217 T220 W250 M254 F256 N257 A258 T259 I263
BS06	SPO	M	W65 F66 I69 G70 Y73 W74 S117 W155 P173 Y175 G176	W65 F66 I69 G70 Y73 W74 S117 W155 P173 Y175 G176
BS07	BCL	M	H180 L181	H180 L181
BS08	BCL	M	A151 L154 W155 T184 N185 S188 L194 F195 H200 S203 I204 Y208 G278 I282	A151 L154 W155 T184 N185 S188 L194 F195 H200 S203 I204 Y208 G278 I282
BS09	BPH	M	S58 G62 F66 S123 W127 A147 F148 A271 T275	S58 G62 F66 S123 W127 A147 F148 A271 T275

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8b64, PDBe:8b64, PDBj:8b64
PDBsum	8b64
PubMed	36738736
UniProt	P11847\|RCEM_RHOCA Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]