Structure of PDB 8afi Chain M

Receptor sequence
>8afiM (length=113) Species: 9606 (Homo sapiens) [Search protein sequence]
FVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVP
SDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEED
FFLYIAYSDESVY
3D structure
PDB8afi Semisynthetic LC3 Probes for Autophagy Pathways Reveal a Noncanonical LC3 Interacting Region Motif Crucial for the Enzymatic Activity of Human ATG3.
ChainM
Resolution2.66 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide M Y5 H9 I21 R28 P30 V31 K46 K48 Y49 L50 V51 R67 F104 Y3 H7 I19 R26 P28 V29 K44 K46 Y47 L48 V49 R65 F102
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0008429 phosphatidylethanolamine binding
GO:0031625 ubiquitin protein ligase binding
GO:0048487 beta-tubulin binding
GO:0050811 GABA receptor binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000226 microtubule cytoskeleton organization
GO:0000422 autophagy of mitochondrion
GO:0006605 protein targeting
GO:0006914 autophagy
GO:0006915 apoptotic process
GO:0006995 cellular response to nitrogen starvation
GO:0007268 chemical synaptic transmission
GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors
GO:0015031 protein transport
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035020 regulation of Rac protein signal transduction
GO:0097352 autophagosome maturation
GO:0098696 regulation of neurotransmitter receptor localization to postsynaptic specialization membrane
GO:1902524 positive regulation of protein K48-linked ubiquitination
Cellular Component
GO:0000139 Golgi membrane
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005776 autophagosome
GO:0005790 smooth endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0005886 plasma membrane
GO:0005930 axoneme
GO:0012505 endomembrane system
GO:0015629 actin cytoskeleton
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0097225 sperm midpiece
GO:0098982 GABA-ergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8afi, PDBe:8afi, PDBj:8afi
PDBsum8afi
PubMed37252361
UniProtO95166|GBRAP_HUMAN Gamma-aminobutyric acid receptor-associated protein (Gene Name=GABARAP)

[Back to BioLiP]