Structure of PDB 7zm7 Chain M |
>7zm7M (length=118) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] |
TGRPASAVMQAPNRAEVWSRSQRPRSEAMAGPRFEQTDFDAQPRPWAAIE LIHKQPVRWTHDRIVACDGGGGPHGHPKIYINTDKPEIATCNYCGLPFAN EHHRKYLESLPQTSYPLN |
|
PDB | 7zm7 Conformational changes in mitochondrial complex I of the thermophilic eukaryote Chaetomium thermophilum. |
Chain | M |
Resolution | 2.77 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
M |
C117 H126 C141 C144 |
C67 H76 C91 C94 |
|
|
|