Structure of PDB 7zg7 Chain M

Receptor sequence
>7zg7M (length=172) Species: 9606 (Homo sapiens) [Search protein sequence]
TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKY
FLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECAL
HLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTN
LRKMGAPESGLAEYLFDKHTLG
3D structure
PDB7zg7 Polyelectrolyte coating of cryo-EM grids improves lateral distribution and prevents aggregation of macromolecules.
ChainM
Resolution1.77 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.16.3.1: ferroxidase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN M D126 H128 D122 H124
BS02 ZN M H128 D131 H124 D127
BS03 ZN M E27 E62 H65 E23 E58 H61
BS04 ZN M Y40 D92 Y36 D88
Gene Ontology
Molecular Function
GO:0004322 ferroxidase activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0008198 ferrous iron binding
GO:0008199 ferric iron binding
GO:0016491 oxidoreductase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0140315 iron ion sequestering activity
Biological Process
GO:0006826 iron ion transport
GO:0006879 intracellular iron ion homeostasis
GO:0006880 intracellular sequestering of iron ion
GO:0006955 immune response
GO:0008285 negative regulation of cell population proliferation
GO:0048147 negative regulation of fibroblast proliferation
GO:0110076 negative regulation of ferroptosis
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005776 autophagosome
GO:0005829 cytosol
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0044754 autolysosome
GO:0070062 extracellular exosome
GO:0070288 ferritin complex
GO:1904724 tertiary granule lumen
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7zg7, PDBe:7zg7, PDBj:7zg7
PDBsum7zg7
PubMed36322417
UniProtP02794|FRIH_HUMAN Ferritin heavy chain (Gene Name=FTH1)

[Back to BioLiP]