Structure of PDB 7yml Chain M

Receptor sequence

>7ymlM (length=304) Species: 1061 (Rhodobacter capsulatus) [Search protein sequence]

AEYQNFFNQVQVAGAPEMGLKEDVDTYERTPAGMLSILGWMGNAQIGPIY
LGIAGTVSLVFGAAWFFTIGVWYWYQAGFDPFIFMRDLFFFSLEPPPAEY
GLALAPLKQGGVWQIASLFMAISVIAWWVRVYTRADQLGMGKHMAWAFLS
AIWLWSVLGFWRPILMGSWSVGVPYGIFSHLDWTNQFSLDHGNLFYNPFH
GLSIAALYGSALLFAMHGATILAVTRFGGERELEQIADRGTASERAALFW
RWTMGFNATMEGIHRWAIWMAVMVTLTGGIGILLSGTVVDNWYVWAQVHG
YAPV

3D structure

PDB

7yml Rhodobacter capsulatus forms a compact crescent-shaped LH1-RC photocomplex.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BPH	M	Y209 L213 M217 M255	Y208 L212 M216 M254
BS02	BCL	M	G202 I205 A206 Y209 L213	G201 I204 A205 Y208 L212
BS03	BCL	M	W156 I178 H181 L182	W155 I177 H180 L181
BS04	BCL	M	A152 L155 W156 T185 N186 F188 S189 L195 F196 H201 S204 I205 Y209 G279 I283	A151 L154 W155 T184 N185 F187 S188 L194 F195 H200 S203 I204 Y208 G278 I282
BS05	BPH	M	S59 G63 F67 S124 W128 A148 F149 A152 A272 T276	S58 G62 F66 S123 W127 A147 F148 A151 A271 T275
BS06	FE	M	H218 E233 H265	H217 E232 H264
BS07	U10	M	M217 H218 T221 W251 M255 F257 N258 A259 I264 W267	M216 H217 T220 W250 M254 F256 N257 A258 I263 W266
BS08	SPO	M	F67 I70 G71 Y74 W75 S118 W156 G160 W170 Y176 H181	F66 I69 G70 Y73 W74 S117 W155 G159 W169 Y175 H180

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7yml, PDBe:7yml, PDBj:7yml
PDBsum	7yml
PubMed	36792596
UniProt	P11847\|RCEM_RHOCA Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]