Structure of PDB 7y8w Chain M

Receptor sequence
>7y8wM (length=86) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]
RKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPT
WHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
3D structure
PDB7y8w Interaction between DLC-1 and SAO-1 facilitates CED-4 translocation during apoptosis in the Caenorhabditis elegans germline.
ChainM
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide M E35 K36 E32 K33
BS02 peptide M D12 R60 N61 F62 G63 S64 Y65 V66 T67 H68 E69 T70 F73 Y75 Y77 D9 R57 N58 F59 G60 S61 Y62 V63 T64 H65 E66 T67 F70 Y72 Y74
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0045505 dynein intermediate chain binding
Biological Process
GO:0006915 apoptotic process
GO:0007017 microtubule-based process
GO:0030473 nuclear migration along microtubule
GO:0051301 cell division
GO:0051321 meiotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0015630 microtubule cytoskeleton
GO:0030286 dynein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y8w, PDBe:7y8w, PDBj:7y8w
PDBsum7y8w
PubMed36323675
UniProtQ22799|DYL1_CAEEL Dynein light chain 1, cytoplasmic (Gene Name=dlc-1)

[Back to BioLiP]