Structure of PDB 7xse Chain M |
>7xseM (length=64) Species: 460519 (Komagataella phaffii) [Search protein sequence] |
IKQKLETQFTCLFCNHDNSVVCTLDKKNSIGLLECKKCNLSFQAPINSLS QPIDIYSDWIDACE |
|
PDB | 7xse Structural basis of nucleosome disassembly and reassembly by RNAPII elongation complex with FACT. |
Chain | M |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
M |
C25 C28 C49 C52 |
C11 C14 C35 C38 |
|
|
|
|