Structure of PDB 7x75 Chain M

Receptor sequence
>7x75M (length=131) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence]
PPVKGRATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTL
QSLADAGEVDVLRTAEGESVYRRCSTGDHHHHLVCRACGKAVEVEGPAVE
KWAEAIAAEHGYVNVAHTVEIFGTCADCAGA
3D structure
PDB7x75 Structural basis of Streptomyces transcription activation by zinc uptake regulator.
ChainM
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna M R14 Q33 Y52 E73 R9 Q28 Y47 E68
BS02 dna M R11 R16 G47 T49 T50 R6 R11 G42 T44 T45
BS03 ZN M C90 C93 C130 C85 C88 C125
BS04 ZN M C79 H85 H87 C74 H80 H82
BS05 ZN M H84 H86 E105 H122 H79 H81 E100 H117
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900376 regulation of secondary metabolite biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7x75, PDBe:7x75, PDBj:7x75
PDBsum7x75
PubMed35871291
UniProtQ9L2H5

[Back to BioLiP]