Structure of PDB 7wbx Chain M |
>7wbxM (length=64) Species: 460519 (Komagataella phaffii) [Search protein sequence] |
IKQKLETQFTCLFCNHDNSVVCTLDKKNSIGLLECKKCNLSFQAPINSLS QPIDIYSDWIDACE |
|
PDB | 7wbx Structural Basis of Damaged Nucleotide Recognition by Transcribing RNA Polymerase II in the Nucleosome. |
Chain | M |
Resolution | 4.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
M |
C25 C28 |
C11 C14 |
|
|
|
|