Structure of PDB 7voy Chain M

Receptor sequence

>7voyM (length=305) Species: 272943 (Cereibacter sphaeroides 2.4.1)

EYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIY
LGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEY
GLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFL
SAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNPF
HGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALF
WRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQNH
GMAPL

3D structure

• PDB: 7voy Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex.
• Chain: M
• Resolution: 4.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	M	G203 I206 A207 Y210	G202 I205 A206 Y209
BS02	FE2	M	M262 H266	M261 H265
BS03	BCL	M	H182 L183	H181 L182
BS04	BCL	M	L156 T186 F189 L196 H202 S205 I206 V276 T277	L155 T185 F188 L195 H201 S204 I205 V275 T276
BS05	BPH	M	W129 A149 F150 A153 A273 V276 T277	W128 A148 F149 A152 A272 V275 T276
BS06	U10	M	H219 T222 A249 W252 A260 M262 I265	H218 T221 A248 W251 A259 M261 I264
BS07	SPN	M	F67 F68 S119 F120 W157 M158 L160 G161 W171 Y177	F66 F67 S118 F119 W156 M157 L159 G160 W170 Y176

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:7voy, PDBe:7voy, PDBj:7voy
• PDBsum: 7voy
• PubMed: 35418573
• UniProt: Q3J1A6|RCEM_CERS4 Reaction center protein M chain (Gene Name=pufM)