Structure of PDB 7v2o Chain M

Receptor sequence
>7v2oM (length=113) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPR
3D structure
PDB7v2o Decoding the Mechanism of Specific RNA Targeting by Ribosomal Methyltransferases.
ChainM
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna M K13 R14 V17 Y21 G24 I25 G26 A28 R29 R88 R91 H92 L96 P97 V98 R99 Q101 R102 T103 R104 T105 N106 A107 R108 T109 K111 R114 K12 R13 V16 Y20 G23 I24 G25 A27 R28 R87 R90 H91 L95 P96 V97 R98 Q100 R101 T102 R103 T104 N105 A106 R107 T108 K110 R113
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7v2o, PDBe:7v2o, PDBj:7v2o
PDBsum7v2o
PubMed35316014
UniProtP80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]