Structure of PDB 7uw1 Chain M

Receptor sequence

>7uw1M (length=119) Species: 480119 (Acinetobacter baumannii AB0057)

MRHRNSGVKLGRTSSHRKAMFENLANSLFEHELIKTTLPKAKELRRVAEP
LITLAKNDTVANRRLAFARTRNAATVGKLFTVLGPRYKERNGGYLRVLKA
GFRAGDAAPMAYVELVDRE

3D structure

• PDB: 7uw1 Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
• Chain: M
• Resolution: 2.21 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	M1 R2 H3 R4 N5 S6 G7 K9 L10 R12 H16 K18 N23 L24 H31 I34 K35 T36 T37 P39 K42 R46 E49 T53 R63 R64 F67 A68 R69 R71 A74 R90 N91 G92 G93 R96 K99 R103 G105 D106 A107	M1 R2 H3 R4 N5 S6 G7 K9 L10 R12 H16 K18 N23 L24 H31 I34 K35 T36 T37 P39 K42 R46 E49 T53 R63 R64 F67 A68 R69 R71 A74 R90 N91 G92 G93 R96 K99 R103 G105 D106 A107

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7uw1, PDBe:7uw1, PDBj:7uw1
• PDBsum: 7uw1
• PubMed: 37192172
• UniProt: B7IA13|RL17_ACIB5 Large ribosomal subunit protein bL17 (Gene Name=rplQ)