Structure of PDB 7uvw Chain M

Receptor sequence
>7uvwM (length=119) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
MRHRNSGVKLGRTSSHRKAMFENLANSLFEHELIKTTLPKAKELRRVAEP
LITLAKNDTVANRRLAFARTRNAATVGKLFTVLGPRYKERNGGYLRVLKA
GFRAGDAAPMAYVELVDRE
3D structure
PDB7uvw Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
ChainM
Resolution2.37 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M M1 R2 H3 R4 N5 S6 G7 K9 R12 H16 N23 L24 H31 I34 T36 K42 R46 E49 T53 R63 R64 R71 R90 N91 G92 G93 R96 K99 R103 G105 D106 A107 M1 R2 H3 R4 N5 S6 G7 K9 R12 H16 N23 L24 H31 I34 T36 K42 R46 E49 T53 R63 R64 R71 R90 N91 G92 G93 R96 K99 R103 G105 D106 A107
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvw, PDBe:7uvw, PDBj:7uvw
PDBsum7uvw
PubMed37192172
UniProtB7IA13|RL17_ACIB5 Large ribosomal subunit protein bL17 (Gene Name=rplQ)

[Back to BioLiP]