Structure of PDB 7q7h Chain M

Receptor sequence

>7q7hM (length=300) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

EYQNIFTQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIY
LGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEY
GLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFL
SAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLHYNPF
HGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALF
WRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQNH

3D structure

PDB

7q7h Towards automated crystallographic structure refinement with phenix.refine.

Chain

Resolution

2.49 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BPH	M	Y210 L214 W252	Y209 L213 W251
BS02	BCL	M	I206 A207 Y210 L214	I205 A206 Y209 L213
BS03	UQ7	M	M218 H219 T222 A249 W252 M256 F258 N259 A260 I265 W268	M217 H218 T221 A248 W251 M255 F257 N258 A259 I264 W267
BS04	BCL	M	L156 T186 N187 F189 S190 L196 H197 H202 S205 I206 Y210 V276 G280 I284	L155 T185 N186 F188 S189 L195 H196 H201 S204 I205 Y209 V275 G279 I283
BS05	BCL	M	H182 L183 T186	H181 L182 T185
BS06	BPH	M	A125 W129 A149 F150 A153 T277	A124 W128 A148 F149 A152 T276
BS07	FE	M	H219 E234 H266	H218 E233 H265
BS08	SPN	M	F67 G71 W75 W115 S119 F120 W157 G161 F162 W171 V175 Y177 H182	F66 G70 W74 W114 S118 F119 W156 G160 F161 W170 V174 Y176 H181

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7q7h, PDBe:7q7h, PDBj:7q7h
PDBsum	7q7h
PubMed
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]