Structure of PDB 7q7g Chain M

Receptor sequence

>7q7gM (length=300) Species: 1063 (Cereibacter sphaeroides)

EYQNIFTQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIY
LGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEY
GLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFL
SAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLHYNPF
HGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALF
WRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQNH

3D structure

• PDB: 7q7g Towards automated crystallographic structure refinement with phenix.refine.
• Chain: M
• Resolution: 2.69 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BPH	M	Y210 L214 W252	Y209 L213 W251
BS02	BCL	M	I206 A207 Y210 L214	I205 A206 Y209 L213
BS03	BPH	M	A125 W129 A149 F150 A153	A124 W128 A148 F149 A152
BS04	UQ7	M	M218 H219 T222 W252 M256 F258 N259 A260 I265 W268	M217 H218 T221 W251 M255 F257 N258 A259 I264 W267
BS05	BCL	M	A153 T186 N187 S190 L196 H202 S205 I206 Y210 G280 I284	A152 T185 N186 S189 L195 H201 S204 I205 Y209 G279 I283
BS06	BCL	M	H182 L183	H181 L182
BS07	FE	M	H219 E234 H266	H218 E233 H265
BS08	SPN	M	F67 G71 W75 W115 F120 W157 G161 F162 W171 V175 Y177 H182	F66 G70 W74 W114 F119 W156 G160 F161 W170 V174 Y176 H181

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:7q7g, PDBe:7q7g, PDBj:7q7g
• PDBsum: 7q7g
• UniProt: P0C0Y9|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)