Structure of PDB 7pit Chain M

Receptor sequence

>7pitM (length=60) Species: 272634 (Mycoplasmoides pneumoniae M129)

AKKSLKVKQTRIPKFAVRAYTRCQRCGRARAVLSHFGVCRLCFRELAYAG
AIPGVKKASW

3D structure

• PDB: 7pit Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: M
• Resolution: 5.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	A2 K3 K4 S5 V8 R12 F16 V18 R19 Y21 T22 C27 R29 R31 A32 V33 S35 H36 L42 R45 K58 W61	A1 K2 K3 S4 V7 R11 F15 V17 R18 Y20 T21 C26 R28 R30 A31 V32 S34 H35 L41 R44 K57 W60

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pit, PDBe:7pit, PDBj:7pit
• PDBsum: 7pit
• PubMed: 36171285
• UniProt: Q50305|RS14Z_MYCPN Small ribosomal subunit protein uS14 (Gene Name=rpsZ)