Structure of PDB 7pis Chain M

Receptor sequence

>7pisM (length=60) Species: 272634 (Mycoplasmoides pneumoniae M129)

AKKSLKVKQTRIPKFAVRAYTRCQRCGRARAVLSHFGVCRLCFRELAYAG
AIPGVKKASW

3D structure

• PDB: 7pis Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: M
• Resolution: 15.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	A2 K3 K4 S5 L6 V8 K9 R12 K15 F16 A17 V18 R19 A20 Y21 R26 G28 R29 A30 R31 A32 L34 S35 H36 C40 R41 L42 C43 R45 E46 Y49 S60 W61	A1 K2 K3 S4 L5 V7 K8 R11 K14 F15 A16 V17 R18 A19 Y20 R25 G27 R28 A29 R30 A31 L33 S34 H35 C39 R40 L41 C42 R44 E45 Y48 S59 W60

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pis, PDBe:7pis, PDBj:7pis
• PDBsum: 7pis
• PubMed: 36171285
• UniProt: Q50305|RS14Z_MYCPN Small ribosomal subunit protein uS14 (Gene Name=rpsZ)