Structure of PDB 7pil Chain M

Receptor sequence

>7pilM (length=307) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HGMAPLN

3D structure

PDB

7pil Cryo-EM structure of the monomeric Rhodobacter sphaeroides RC-LH1 core complex at 2.5 angstrom.

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BPH	M	Y210 L214 W252	Y210 L214 W252
BS02	BCL	M	G203 I206 A207 Y210 G211 L214	G203 I206 A207 Y210 G211 L214
BS03	BPH	M	G63 F67 W129 A149 F150 A153 T277	G63 F67 W129 A149 F150 A153 T277
BS04	BCL	M	L156 L160 T186 N187 F189 L196 F197 H202 S205 I206 Y210 G280 I284	L156 L160 T186 N187 F189 L196 F197 H202 S205 I206 Y210 G280 I284
BS05	U10	M	M218 H219 T222 A249 W252 M256 N259 A260 I265 W268	M218 H219 T222 A249 W252 M256 N259 A260 I265 W268
BS06	BCL	M	I179 H182 L183 T186	I179 H182 L183 T186
BS07	SPO	M	F67 I70 G71 F74 W75 F105 S119 W157 G161 V175 H182	F67 I70 G71 F74 W75 F105 S119 W157 G161 V175 H182
BS08	FE	M	H219 E234 H266	H219 E234 H266

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pil, PDBe:7pil, PDBj:7pil
PDBsum	7pil
PubMed	34590677
UniProt	Q3J1A6\|RCEM_CERS4 Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]