Structure of PDB 7pib Chain M

Receptor sequence
>7pibM (length=60) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
AKKSLKVKQTRIPKFAVRAYTRCQRCGRARAVLSHFGVCRLCFRELAYAG
AIPGVKKASW
3D structure
PDB7pib Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainM
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M A2 K3 K4 S5 K9 R12 F16 A17 V18 Y21 C27 R29 R31 A32 V33 S35 R41 R45 K58 A59 S60 W61 A1 K2 K3 S4 K8 R11 F15 A16 V17 Y20 C26 R28 R30 A31 V32 S34 R40 R44 K57 A58 S59 W60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pib, PDBe:7pib, PDBj:7pib
PDBsum7pib
PubMed36171285
UniProtQ50305|RS14Z_MYCPN Small ribosomal subunit protein uS14 (Gene Name=rpsZ)

[Back to BioLiP]