Structure of PDB 7p6z Chain M

Receptor sequence
>7p6zM (length=60) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
AKKSLKVKQTRIPKFAVRAYTRCQRCGRARAVLSHFGVCRLCFRELAYAG
AIPGVKKASW
3D structure
PDB7p6z Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainM
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M A2 K3 K4 S5 L6 V8 K9 R12 K15 F16 V18 R19 Y21 T22 C27 R29 R31 A32 S35 R41 L42 R45 K58 S60 W61 A1 K2 K3 S4 L5 V7 K8 R11 K14 F15 V17 R18 Y20 T21 C26 R28 R30 A31 S34 R40 L41 R44 K57 S59 W60
BS02 ZN M C24 C40 C43 C23 C39 C42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p6z, PDBe:7p6z, PDBj:7p6z
PDBsum7p6z
PubMed36171285
UniProtQ50305|RS14Z_MYCPN Small ribosomal subunit protein uS14 (Gene Name=rpsZ)

[Back to BioLiP]