Structure of PDB 7p2c Chain M

Receptor sequence

>7p2cM (length=302) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]

AEYQNIFTQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLHYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HG

3D structure

PDB

7p2c X-ray structure of the Rhodobacter sphaeroides reaction center with an M197 Phe→His substitution clarifies the properties of the mutant complex.

Chain

Resolution

2.04 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	H197 Y210	H197 Y210
BS02	BCL	M	G203 I206 A207 Y210	G203 I206 A207 Y210
BS03	BPH	M	Y210 L214 W252	Y210 L214 W252
BS04	NKP	M	H145 R267	H145 R267
BS05	U10	M	M218 H219 T222 W252 M256 N259 A260 M262 I265 W268	M218 H219 T222 W252 M256 N259 A260 M262 I265 W268
BS06	NKP	M	G143 K144 H145 W148 L151 W155	G143 K144 H145 W148 L151 W155
BS07	BCL	M	W66 I179 H182 L183	W66 I179 H182 L183
BS08	BCL	M	A153 L156 T186 N187 F189 S190 L196 H197 H202 S205 I206 Y210 V276 G280 I284	A153 L156 T186 N187 F189 S190 L196 H197 H202 S205 I206 Y210 V276 G280 I284
BS09	BPH	M	F67 W129 A149 F150 A153 A273	F67 W129 A149 F150 A153 A273
BS10	FE	M	H219 E234 H266	H219 E234 H266
BS11	SPN	M	F67 I70 G71 F74 W75 S119 F120 W157 G161 F162 W171 V175 Y177 H182	F67 I70 G71 F74 W75 S119 F120 W157 G161 F162 W171 V175 Y177 H182

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7p2c, PDBe:7p2c, PDBj:7p2c
PDBsum	7p2c
PubMed	35371503
UniProt	Q3J1A6\|RCEM_CERS4 Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]