Structure of PDB 7onb Chain M

Receptor sequence

>7onbM (length=47) Species: 9606 (Homo sapiens)

NKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAA

3D structure

• PDB: 7onb Structural basis of intron selection by U2 snRNP in the presence of covalent inhibitors.
• Chain: M
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	L62 H63 S68 H72 G75 K76 K77	L22 H23 S28 H32 G35 K36 K37
BS02	ZN	M	C56 C59 H72 H78	C16 C19 H32 H38

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000245 spliceosomal complex assembly
• GO:0000389 mRNA 3'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0010976 positive regulation of neuron projection development
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0016607 nuclear speck
• GO:0071004 U2-type prespliceosome
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:7onb, PDBe:7onb, PDBj:7onb
• PDBsum: 7onb
• PubMed: 34301950
• UniProt: Q15428|SF3A2_HUMAN Splicing factor 3A subunit 2 (Gene Name=SF3A2)