Structure of PDB 7ml0 Chain M

Receptor sequence

>7ml0M (length=279) Species: 4932 (Saccharomyces cerevisiae)

PNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRT
FNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMDKKDNEVQAAFAK
ITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRR
AEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSQNLTYIPRFCSHLG
LPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAK
VGQTLQVTEGTIKSGYKILYEHRDKLVDP

3D structure

• PDB: 7ml0 Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
• Chain: M
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	M	K164 K272 T305	K132 K225 T258
BS02	ZN	M	C24 C27 C45 C48	C9 C12 C30 C33

Gene Ontology

Molecular Function

• GO:0000993 RNA polymerase II complex binding
• GO:0001139 RNA polymerase II complex recruiting activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0016251 RNA polymerase II general transcription initiation factor activity
• GO:0017025 TBP-class protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001113 transcription open complex formation at RNA polymerase II promoter
• GO:0001174 transcriptional start site selection at RNA polymerase II promoter
• GO:0006352 DNA-templated transcription initiation
• GO:0006367 transcription initiation at RNA polymerase II promoter
• GO:0010467 gene expression
• GO:0051123 RNA polymerase II preinitiation complex assembly
• GO:0070897 transcription preinitiation complex assembly

Cellular Component

• GO:0005634 nucleus
• GO:0097550 transcription preinitiation complex

External links

• PDB: RCSB:7ml0, PDBe:7ml0, PDBj:7ml0
• PDBsum: 7ml0
• PubMed: 35051353
• UniProt: P29055|TF2B_YEAST Transcription initiation factor IIB (Gene Name=SUA7)