Structure of PDB 7mbm Chain M |
>7mbmM (length=105) Species: 8355 (Xenopus laevis) [Search protein sequence] |
KAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEI LELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQ SVLLP |
|
PDB | 7mbm Regulation of MLL1 Methyltransferase Activity in Two Distinct Nucleosome Binding Modes. |
Chain | M |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
M |
K13 R17 |
K1 R5 |
|
BS02 |
dna |
M |
V43 T76 |
V31 T64 |
|
|
|
|