Structure of PDB 7m75 Chain M

Receptor sequence
>7m75M (length=31) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
MALTDTQVYVALVIALLPAVLAFRLSTELYK
3D structure
PDB7m75 Room temperature XFEL crystallography reveals asymmetry in the vicinity of the two phylloquinones in photosystem I.
ChainM
Resolution2.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA M S26 L29 K31 S26 L29 K31
BS02 CLA M R24 T27 R24 T27
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m75, PDBe:7m75, PDBj:7m75
PDBsum7m75
PubMed34750381
UniProtP0A403|PSAM_THEVB Photosystem I reaction center subunit XII (Gene Name=psaM)

[Back to BioLiP]