Structure of PDB 7lhd Chain M

Receptor sequence

>7lhdM (length=419) Species: 39803 (Qubevirus durum)

PKLPRGLRFGADNEILNDFQELWFPDLFIESSDTHPWYTLKGRVLNAHLD
DRLPNVGGRQVRRTPHRVTVPIASSGLRPVTTVQYDPAALSFLLNARVDW
DFGNGDSANLVINDFLFRTFAPKEFDFSNSLVPRYTQAFSAFNAKYGTMI
GEGLETIKYLGLLLRRLREGYRAVKRGDLRALRRVIQSYHNGKWKPATAG
NLWLEFRYGLMPLFYDIRDVMLDWQNRHDKIQRLLRFSVGHGEDYVVEFD
NLYPAVAYFKLKGEITLERRHRHGISYANREGYAVFDNGSLRPVSDWKEL
ATAFINPHEVAWELTPYSFVVDWFLNVGDILAQQGQLYHNIDIVDGFDRR
DIRLKSFTIKGERNGRPVNVSASLSAVDLFYSRLHTSNLPFATLDLDTTF
SSFKHVLDSIFLLTQRVKR

3D structure

• PDB: 7lhd Structural Assembly of Q beta Virion and Its Diverse Forms of Virus-like Particles.
• Chain: M
• Resolution: 4.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	I15 H66 R67 V68 T69 R78 P79 V80 T81 Y85 K158 R165 R172 R176 R180 R184 G192 K193 K230 R236 V294 F347 R349 R353 Y381 R383 R416	I15 H66 R67 V68 T69 R78 P79 V80 T81 Y85 K158 R165 R172 R176 R180 R184 G192 K193 K230 R236 V294 F347 R349 R353 Y381 R383 R416

Gene Ontology

Biological Process

• GO:0031640 killing of cells of another organism
• GO:0039635 suppression by virus of host peptidoglycan biosynthetic process
• GO:0039636 suppression by virus of host cell wall biogenesis
• GO:0039640 viral release via suppression of host peptidoglycan biosynthetic process
• GO:0039666 virion attachment to host cell pilus
• GO:0044659 viral release from host cell by cytolysis
• GO:0046718 symbiont entry into host cell
• GO:0098671 adhesion receptor-mediated virion attachment to host cell

Cellular Component

• GO:0044423 virion component

External links

• PDB: RCSB:7lhd, PDBe:7lhd, PDBj:7lhd
• PDBsum: 7lhd
• PubMed: 35215818
• UniProt: Q8LTE2|MATA2_BPQBE Maturation protein A2