Structure of PDB 7k7g Chain M

Receptor sequence
>7k7gM (length=43) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TQLKSKHPCSVCTRRKVKCDRMIPCGNCRKRGQDSECMKSTKL
3D structure
PDB7k7g Structural and dynamic mechanisms of CBF3-guided centromeric nucleosome formation.
ChainM
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna M K11 H12 P13 K21 V22 K23 C24 K6 H7 P8 K16 V17 K18 C19
BS02 dna M R20 K21 R15 K16
BS03 ZN M C14 C30 C9 C25
BS04 ZN M C14 C30 C9 C25
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7k7g, PDBe:7k7g, PDBj:7k7g
PDBsum7k7g
PubMed33741944
UniProtP40969|CBF3B_YEAST Centromere DNA-binding protein complex CBF3 subunit B (Gene Name=CEP3)

[Back to BioLiP]