Structure of PDB 7f0l Chain M

Receptor sequence

>7f0lM (length=306) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

AEYQNIFTQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HGMAPL

3D structure

PDB

7f0l A previously unrecognized membrane protein in the Rhodobacter sphaeroides LH1-RC photocomplex.

Chain

Resolution

2.94 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BPH	M	Y210 L214 W252 M256	Y210 L214 W252 M256
BS02	U10	M	L89 F90	L89 F90
BS03	BCL	M	G203 I206 A207 Y210	G203 I206 A207 Y210
BS04	BCL	M	I179 H182 L183	I179 H182 L183
BS05	BCL	M	L156 W157 T186 F189 L196 F197 H202 S205 I206 Y210 G280 I284	L156 W157 T186 F189 L196 F197 H202 S205 I206 Y210 G280 I284
BS06	BPH	M	G63 L64 W129 A149 F150 A153 A273 T277	G63 L64 W129 A149 F150 A153 A273 T277
BS07	FE	M	H219 E234 H266	H219 E234 H266
BS08	U10	M	H219 T222 W252 M256 F258 N259 A260 T261 I265 W268	H219 T222 W252 M256 F258 N259 A260 T261 I265 W268
BS09	SPO	M	F67 I70 G71 W75 F105 W115 S119 W157 G161 Y177 H182	F67 I70 G71 W75 F105 W115 S119 W157 G161 Y177 H182

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7f0l, PDBe:7f0l, PDBj:7f0l
PDBsum	7f0l
PubMed	34728609
UniProt	Q3J1A6\|RCEM_CERS4 Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]