Structure of PDB 7c9r Chain M

Receptor sequence

>7c9rM (length=318) Species: 631362 (Thiorhodovibrio frisius)

PEYQNIFNKVQVREPAYPGVELPKGSLPRVGKPIFSYWLGKIGDAQIGPL
YLGGWGIASLISGFIALEVIGLNMLASVGWDPRLFLKEFFWLGLEPPPPA
YGLSIPPLAEGGWWLIAGLFLTMSLLLWWVRVYKRAKDLGMGTHLSWAFA
VAILFFLTLGFIRPVLMGSWGEAPPFGIFPHLDWTAAISIRYGNFYYNPF
HGLSIAFMYGSAVLFAMHGGTILAVSRYGGDREIDQITDRGTAAERAMLF
WRWCMGFNASMESIHRWAWWFAVFCIINSILGIILTGTVVDNWYLWAVKH
GVAPSYPSELTIDNPYLT

3D structure

• PDB: 7c9r Cryo-EM structure of a Ca 2+ -bound photosynthetic LH1-RC complex containing multiple alpha beta-polypeptides.
• Chain: M
• Resolution: 2.82 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BPH	M	Y210 V214	Y209 V213
BS02	BCL	M	I206 A207 Y210	I205 A206 Y209
BS03	FE	M	H219 E234 H266	H218 E233 H265
BS04	BCL	M	H182 L183	H181 L182
BS05	BCL	M	T186 F196 Y197 H202 S205 I206 S280 I284	T185 F195 Y196 H201 S204 I205 S279 I283
BS06	BPH	M	S125 W129 F150	S124 W128 F149
BS07	MQ8	M	H219 W252 N259 A260 I265	H218 W251 N258 A259 I264
BS08	H4X	M	L73 M75 G119 F157 G161 P175 F177 G178	L72 M74 G118 F156 G160 P174 F176 G177

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:7c9r, PDBe:7c9r, PDBj:7c9r
• PDBsum: 7c9r
• PubMed: 33009385
• UniProt: G1BIY7