Structure of PDB 7c52 Chain M

Receptor sequence

>7c52M (length=318) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]

PEYQNIFTAVQVRAPAYPGVPLPKGNLPRIGRPIFSYWLGKIGDAQIGPI
YLGLTGTLSIFFGLVAISIIGFNMLASVHWDVFQFLKHFFWLGLEPPPPQ
YGLRIPPLSEGGWWLMAGLFLTLSILLWWVRTYKRAEALGMSQHLSWAFA
AAIFFYLVLGFIRPVMMGSWAKAVPFGIFPHLDWTAAFSIRYGNLYYNPF
HMLSIAFLYGSALLFAMHGATILSVSRFGGDREIDQITHRGTAAERAALF
WRWTMGFNVTMESIHRWAWWCAVLTVITAGIGILLSGTVVDNWYLWAVKH
GMAPAYPEVVTAVNPYET

3D structure

PDB

7c52 Crystal structure of a photosynthetic LH1-RC in complex with its electron donor HiPIP.

Chain

Resolution

2.89 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	M	M203 I206 A207 Y210 G211 L214	M202 I205 A206 Y209 G210 L213
BS02	BPH	M	Y210 L214 M218 W252	Y209 L213 M217 W251
BS03	BCL	M	I179 H182 L183	I178 H181 L182
BS04	UQ8	M	F91 I179	F90 I178
BS05	BCL	M	F156 T186 F189 S190 L196 Y197 H202 S205 I206 Y210 A280 I284	F155 T185 F188 S189 L195 Y196 H201 S204 I205 Y209 A279 I283
BS06	BPH	M	L65 I68 S125 W129 L146 A149 F150 A273 V277	L64 I67 S124 W128 L145 A148 F149 A272 V276
BS07	FE	M	H219 E234 H266	H218 E233 H265
BS08	MQ8	M	L214 M218 H219 A248 W252 M256 F258 N259 V260 M262 I265 W268	L213 M217 H218 A247 W251 M255 F257 N258 V259 M261 I264 W267
BS09	CRT	M	I68 G72 M75 L116 G119 L120 T123 Y157 G161 F162 W171 V175 F177 G178 H182	I67 G71 M74 L115 G118 L119 T122 Y156 G160 F161 W170 V174 F176 G177 H181
BS10	UQ8	M	L65 V66 S69	L64 V65 S68

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7c52, PDBe:7c52, PDBj:7c52
PDBsum	7c52
PubMed	33597527
UniProt	A8ASG6

[Back to BioLiP]