Structure of PDB 7ane Chain M

Receptor sequence

>7aneM (length=259) Species: 5664 (Leishmania major)

PKPAPRYNIGLRPAPKRQNVGGQFLATQKHYARELWYKRQYYSTRPFAIQ
KHMGSTPRILLDRTLWRSCWLTKSNLPDVNRWEKVVNSQRVTEDRWALVE
EDGVMYQVNWKMYCERLETELQKAQDQLPQYSFMMKAVPSAWKKLDIELS
VLRGLSVREAMAQCKLSPRKGHMAVFRALEVAQQGAEGKGLDKEHLRIAY
ITCMPGPTDKQVDIRSRGYYAWKTKKSSHLLLTLAEDPEMVLPDRTAIPY
ASLMTMKRA

3D structure

• PDB: 7ane Structure of the mature kinetoplastids mitoribosome and insights into its large subunit biogenesis.
• Chain: M
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	K3 P4 G11 R13 K17 R18 Q19 N20 G22 G23 Q24 F25 L26 Q29 K30 H31 Y32 R34 R40 Q41 Y42 R46 F48 Q51 K52 M54 G55 T57 L62 R64 R68 C70 L72 K74 W83 K85 V86 E94 R96 W97 K137 K144 K145 P169 R170 K171 M205 P206 G207 P208 I215 R216 S217 R218 G219 Y220 A222 T225 K226 H230	K2 P3 G10 R12 K16 R17 Q18 N19 G21 G22 Q23 F24 L25 Q28 K29 H30 Y31 R33 R39 Q40 Y41 R45 F47 Q50 K51 M53 G54 T56 L61 R63 R67 C69 L71 K73 W82 K84 V85 E93 R95 W96 K136 K143 K144 P168 R169 K170 M204 P205 G206 P207 I214 R215 S216 R217 G218 Y219 A221 T224 K225 H229

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ane, PDBe:7ane, PDBj:7ane
• PDBsum: 7ane
• PubMed: 33168716
• UniProt: Q4QBR0