Structure of PDB 6zzx Chain M

Receptor sequence
>6zzxM (length=31) Species: 2649997 (Chlorella ohadii) [Search protein sequence]
MPIADYQVFTALFLALATGIFAVRLGVALYK
3D structure
PDB6zzx Cryo-EM photosystem I structure reveals adaptation mechanisms to extreme high light in Chlorella ohadii.
ChainM
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA M G26 L29 Y30 G26 L29 Y30
BS02 CLA M A11 L12 A11 L12
BS03 ECH M A15 L16 G19 A22 A15 L16 G19 A22
BS04 CLA M F9 L12 F13 F9 L12 F13
BS05 CLA M V23 R24 V27 V23 R24 V27
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zzx, PDBe:6zzx, PDBj:6zzx
PDBsum6zzx
PubMed34462576
UniProtW8SU98

[Back to BioLiP]