Structure of PDB 6zxd Chain M

Receptor sequence
>6zxdM (length=119) Species: 9606 (Homo sapiens) [Search protein sequence]
GVMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEP
MYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIKPRKVVGCSCVVVKD
YGKESQAKDVIEEYFKCKK
3D structure
PDB6zxd Structural basis for the final steps of human 40S ribosome maturation.
ChainM
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M G34 S107 G25 S94
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
GO:0090263 positive regulation of canonical Wnt signaling pathway
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0043231 intracellular membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zxd, PDBe:6zxd, PDBj:6zxd
PDBsum6zxd
PubMed33208940
UniProtP25398|RS12_HUMAN Small ribosomal subunit protein eS12 (Gene Name=RPS12)

[Back to BioLiP]