Structure of PDB 6y7c Chain M

Receptor sequence
>6y7cM (length=125) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
QTAEVTIEDALKVVLRTALVHDGLARGLRESTKALTRGEALLVVLVSSVT
EANIIKLVEGLANDPENKVPLIKVADAKQLGEWAGLGKIDREGNARKVVG
ASVVVVKNWGAETDELSMIMEHFSQ
3D structure
PDB6y7c Good Vibrations: Structural Remodeling of Maturing Yeast Pre-40S Ribosomal Particles Followed by Cryo-Electron Microscopy.
ChainM
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M V37 H38 D39 L41 A42 R43 L45 R46 E47 E56 G102 L103 I106 N111 A112 R113 V115 K124 N125 V20 H21 D22 L24 A25 R26 L28 R29 E30 E39 G85 L86 I89 N94 A95 R96 V98 K107 N108
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
GO:0042274 ribosomal small subunit biogenesis
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6y7c, PDBe:6y7c, PDBj:6y7c
PDBsum6y7c
PubMed32138239
UniProtP48589|RS12_YEAST Small ribosomal subunit protein eS12 (Gene Name=RPS12)

[Back to BioLiP]